SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000056900 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000056900
Domain Number 1 Region: 409-546
Classification Level Classification E-value
Superfamily TIMP-like 5.1e-23
Family Netrin-like domain (NTR/C345C module) 0.014
Further Details:      
 
Domain Number 2 Region: 188-284
Classification Level Classification E-value
Superfamily Immunoglobulin 2.37e-21
Family I set domains 0.026
Further Details:      
 
Domain Number 3 Region: 359-416
Classification Level Classification E-value
Superfamily BPTI-like 2.27e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0025
Further Details:      
 
Domain Number 4 Region: 109-159
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000104
Family Ovomucoid domain III-like 0.039
Further Details:      
 
Domain Number 5 Region: 311-356
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000411
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.022
Further Details:      
 
Domain Number 6 Region: 28-76
Classification Level Classification E-value
Superfamily Elafin-like 0.000000116
Family Elafin-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000056900   Gene: ENSRNOG00000021578   Transcript: ENSRNOT00000060156
Sequence length 552
Comment pep:known chromosome:Rnor_5.0:10:15056372:15058700:-1 gene:ENSRNOG00000021578 transcript:ENSRNOT00000060156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAPQPLLPLLFAFVLIHLTSETNLLPEPGSHPGMCPNQLSPHLWVDAQSTCERECTRDQ
DCAASEKCCTNVCGLQSCVAARFPSGGPATPETAASCEDFQCPQQGSNCDIWDGQPVCRC
RDRCEKEPSFTCASDGLTYYNRCYMDAEACLRGLHLHVVPCKHILSWPPSSPGPPETTAR
PTPGAAPMPPALYNSPSPQAVHVGGTASLHCDVSGRPPPAVTWEKQSHQRENLIMRPDQM
YGNVVVTSIGQLVLYNAQLEDAGLYTCTARNAAGLLRADFPLSVLQRATTQDRDPGVLAL
AECQPDTQACVGPPTPHHVLWRFDPQRGSCMTFPALKCDGAARGFETYEACQQACVRGPG
DVCALPPVQGPCQGWEPRWAYSPLLQQCHPFIYSGCEGNSNNFESRESCEDACPVPRTPP
CRACRLKSKLALSLCRSDFAIVGRLTEVLEEPEAAGGIARVALDDVLKDDKMGLKFLGTK
YLEVTLSGMDWACPCPNVTVGDGPLVIMGEVREGVAVLDANSYVRAASEKRVKKIVELLE
KKACELLNRFQD
Download sequence
Identical sequences P0C5J5
ENSRNOP00000056900 ENSRNOP00000056900 10116.ENSRNOP00000056900 NP_001123248.1.100692 NP_001123248.1.4139 NYSGRC-IgSF-ENSRNOP00000056900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]