SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000058668 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000058668
Domain Number 1 Region: 31-304,608-626
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.18e-36
Family Calpain large subunit, catalytic domain (domain II) 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000058668
Domain Number - Region: 762-830
Classification Level Classification E-value
Superfamily Globin-like 0.000507
Family Globins 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000058668   Gene: ENSRNOG00000042741   Transcript: ENSRNOT00000061956
Sequence length 1639
Comment pep:known_by_projection chromosome:Rnor_5.0:1:6109841:6231640:-1 gene:ENSRNOG00000042741 transcript:ENSRNOT00000061956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYPFGSNVPPGSSEQKRGKFPIWPEWSEADINAEKWDAGKGGKEKDKTGKSPIFHFFEDP
EGKIELPQSLKVFSWKRPQDFIFSRIPVVVKNEMTFDLFSSNGHLLCSELMRWIISEIYA
VWKIFNGGILSNYYKGNSGELPILPWKPWEHIYSLCKAAKGHMPLFNSYGKYVVKLYWMG
CWRKITVDDFLPFDEDNNLLLPATTYDFELWPMLLSKAIIKLANVDIHVAHRRELGELTV
IHALTGWLPEVIPLHPAYVDKVWELLKEILPEFKLTEEPSSESKITVIENKLKEPTKENK
DDGKETKDGKETKDAKDFKPEISLTTLKAPEKGDRAAKEKADAKDLGKKNKKDGEKEKER
FKFSLHGSRPSSDVQYSMQSLSDCSSAIQSPQMVVYATFTPLYLFENKIFTLEKMANSAE
KLREYGLSHICSHPVLVTRSRSCPLVAPPKPPPLPAWKLIRHKKETVITDEAQDAVPKKP
EQFLEISSPFLNYRMAPFTIPTETHFVQSVIKKGTPLGSSLPPLVESDLAASTSQGEMSI
IAGNQSQANIALQTTPGKETYEPSEPALADAHQLEAISLERDLISLTTATLDKSQEELAV
NESVSKEIWLDFEDFCVCFHHIYIFHKPNSYCLNFQKSEFKFMEERVPYYLFVDSLKPIE
LLVCFSALVRWGESGALTKESPPVEPGLLTAEAITWKSLKPLSVVLRIHTYATKASMVRL
PVGRHMLLFNAYSPVGHAIHVCSMTTFVIGDEDVVLPNFEPESYRFTEQSVMIMKAIGNV
IANFKDRGKLPAALRDLQAAHYPIPLNNKELTLQHFRVFHISLWRLMKKSQVAKPPLNFK
FAFRAMVLDTDLLDSFSEDASLAEWVDLKYSMPVNEKEYSPEEIAAAVKIQSMWKGNYVR
LLMKARTPETKENISVADTLQKIWAVLEMNLEQYALSLLRLMFKSKCKSMESYPCYQDEE
TKLAFADHTVNYTDQPPNSWFIVFRQYETFLVPQDIILLPKVYTTLQICMLHVINNDTLE
QVPKVFQKVVPYLYSKNKKGYTFVAEAYTGDSFVSGSRWKLRLIGSYNPLPFLARDTPCS
TFTIKEIRDYYIPNDKKILFRYSIKVTMAQSITIQVRTSKPDAFIKLQVLESEEIIMSTV
GKGQALIPAFYFLGNEKALSSQSSKQVLLTHTLPKKEPEVLTKKKAGQPGQKSFKGRTGG
GMTETGMPLLEEEVMSVPTIEENSSTPQQCYKYIIQCLVLFNSWPLNETQLTFVQALKDM
EKIDIKAHVEKHEEPAPMGSPDSHAVSEGQKSVGMPKTTRKGKERSAEKEKSAREKQTPR
FEPQQMQVPTAAHSQQEDPNKPYWTLRLVSEHTDSEYVDVKKDTERADEIRAMKQAWETT
EPGRAIKASQARLKYLTQFIKKPPETSAPATSPEALSVTQSQIKSSEEGQLSTGKDADTK
ELPPTAAGSMLWKKWQLTKTLSVLSKATSSESSPKEEPPRKEIPVVVQSRSPTILETSPQ
QIRKALEFLDFNHYVRKTADEAVLQTDELSKHQAMQKAEEIHQFRQYRARILSIRDIDQE
ERVKLKDEVLDMYGEMRDSVDEARQKIFDIREEYRNKLLEAERLRMEALAAQEAAVKLEA
EKKTAASDPQKKKKGGKKK
Download sequence
Identical sequences ENSRNOP00000058668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]