SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000058685 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000058685
Domain Number 1 Region: 78-340
Classification Level Classification E-value
Superfamily Caspase-like 1.64e-77
Family Caspase catalytic domain 0.000000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000058685   Gene: ENSRNOG00000033697   Transcript: ENSRNOT00000061973
Sequence length 341
Comment pep:known chromosome:Rnor_5.0:8:2658133:2673885:1 gene:ENSRNOG00000033697 transcript:ENSRNOT00000061973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HVLKLKEEEKQKFNNAERSDKRWVFVDVLKRKHNQVGKMLLQTFLNVDSGSHHGEANLEM
EEPEESVDTLKLCSSEEFTRLCREKKQEIYPIKETNGRTRKALIICNTEFKHLSLRYGAN
IDISGMKGLLEELGYDVVVKEELTAEGMESEMKDFAALSEHQTSDSTFLVLMSHGTLQGL
CGTMHSEATPDVLLYDTIYQIFNNCHCPGLRDKPKVIIVQACRGGNPGEVWIRESSGAHS
YRAVDLPRNMEADAVRMSHVEKDFIALYSTTPHHLSYRDKTRGSYFISKLISCFRIHACS
CHLFDIFLKVQQSFEKASINSQMPTIDRATLTRYFYLFPGN
Download sequence
Identical sequences ENSRNOP00000058685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]