SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000058806 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000058806
Domain Number - Region: 9-46
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0262
Family PHD domain 0.075
Further Details:      
 
Domain Number - Region: 18-103
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0824
Family Snake venom toxins 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000058806   Gene: ENSRNOG00000042925   Transcript: ENSRNOT00000067297
Sequence length 109
Comment pep:known chromosome:Rnor_5.0:8:37028583:37029952:-1 gene:ENSRNOG00000042925 transcript:ENSRNOT00000067297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNEPKLGIILLLCMQTALALLCRECTSYLHQKCLHEMKTCTAKDGESCLTVRVWNIPYS
EQVPNEAYSRCQKNCTTDEYYYGDYTVMIKCCEAYDFCNDLLVPISEWS
Download sequence
Identical sequences D3Z9X9
ENSRNOP00000058806 NP_001102228.1.100692 NP_001102228.1.4139 ENSRNOP00000058806 10116.ENSRNOP00000058806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]