SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000058873 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000058873
Domain Number 1 Region: 1213-1370
Classification Level Classification E-value
Superfamily C-type lectin-like 1.61e-41
Family C-type lectin domain 0.00000564
Further Details:      
 
Domain Number 2 Region: 2-110
Classification Level Classification E-value
Superfamily C-type lectin-like 1.37e-40
Family Link domain 0.0026
Further Details:      
 
Domain Number 3 Region: 104-206
Classification Level Classification E-value
Superfamily C-type lectin-like 8.83e-29
Family Link domain 0.0039
Further Details:      
 
Domain Number 4 Region: 1371-1429
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000347
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 5 Region: 1168-1208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000152
Family EGF-type module 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000058873   Gene: ENSRNOG00000029212   Transcript: ENSRNOT00000067456
Sequence length 1473
Comment pep:known chromosome:Rnor_5.0:2:18363890:18441931:-1 gene:ENSRNOG00000029212 transcript:ENSRNOT00000067456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVVFHYRAATSRYTLNFESAQQACLDIGAVIATPEQLFAAYEDGFEQCDAGWLSDQTVRY
PIRAPREGCYGDMMGKEGVRTYGFRSPQETYDVYCYVDHLDGDVFHITAPSKFTFEEAEA
ECANRDARLATVGELHAAWRNGFDQCDYGWLSDASVRHPVTVARAQCGGGLLGVRTLYRF
ENQTCFPLPDSRFDAYCFKPKQNISEATTIETNTLAETASPSLSKEPHMVPERATPVIPL
VTELPIFTTHFPPAGNIVNSEQKSVIYSQAITDRVATESPTAAGSPINSWDADDYLPSGS
GPLGKPDISEIKEEGLQSTTVTSQHATASHHGITEDTQTHESVTQIEQIEVGPLVTSMEI
TNHISFKEFLETKTPLESTEVTLEQHQTDMPTVITSPELATTSHYGVTLREDDREDIALT
VRSGQSTRVFSQIPEVITVSKTSEDTTYSQLGDLEFVSTATITMLGTDGSLTDEGKEPQT
DDKTAEDEFGQSQPTIPFPSQHLTEVESLPYSGDTISVERISTVSYPSLQTDVTQGRERT
EVPRPGLKKDPYAVDEIQEKITKDPFIGTIEEGFSGMSLSTSSSETSAERTESVSPALTI
EKLTVKPAVASDVDEMTILTRLETDVPTSDEDVTSAHLTHSTLNVEVVTVLKWPGNEDNS
TSKPLPPTERAGFTKSPPVSLSTVGIVGKDKETPSFTDGGDEYTLSLDGTPKPLEKFSEE
DLTSGEFAVTIPTSISIDSAEKSTLGEPTTGDRVLSTTSTKDLVINATVEGSALDEDMDA
SKPLFTATPFVHTSDVEESAFVNYSSTQQPTTYVDISHTSPLSIIPKTEWSVSETSVPLE
DEVLGKSDQDTLEQTHLEATMSPEALSTIEVTQGETQEEPQTPGIPFPALSSTAVMTKET
TAFEEEGEGSTYTLSEDRLMTDSEIVPSLETTPVGTSYPGGAMTQQGVEMDTMVTQMSSI
RPTVVLSTEPEVSYEAEGSSPMEFASTLKPFGTQVTQLVEETTEEGKKTPLDYTDLGSGL
FEQPRVTELPDFSMTPSDISVFTAIDSLHRTTPLRPPSPFTEEPHIFEKEPSEKTTGDII
LPRESVTQHPLTTLMDIIAKKTESDIDHEYHMTSKPPVMQPTRPSVVERKTTSKPQELST
SSPPAGTKFHPDINVYIIEVRENKTGPDLCKTNPCLNGGTCYPTETSYVCTCAPGYSGDQ
CELDFDECHSNPCRNGATCVDGLNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKY
FAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGS
ALQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVE
NAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAMPKITCMNPSAYQRTYS
KKYLKNSSSVKDNSINTSKHEHRWSRRWQETRR
Download sequence
Identical sequences D3Z9N6
ENSRNOP00000058873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]