SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000058884 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000058884
Domain Number 1 Region: 1-150
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.2e-33
Family Nuclear receptor ligand-binding domain 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000058884   Gene: ENSRNOG00000020836   Transcript: ENSRNOT00000067042
Sequence length 161
Comment pep:known chromosome:Rnor_5.0:2:215109109:215116316:1 gene:ENSRNOG00000020836 transcript:ENSRNOT00000067042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVVLVRMCRAYNANNHTVFFEGKYGGVELFRALGCSELISSIFDFSHFLSALCFSEDEI
ALYTALVLINANRPGLQEKRRVEHLQYNLELAFHHHLCKTHRQGLLAKLPPKGKLRSLCS
QHVEKLQDFQHLHPIVVQAAFPPLYKELFSTDIESSEGLSK
Download sequence
Identical sequences B5DFL4
ENSRNOP00000058884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]