SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000059027 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000059027
Domain Number 1 Region: 25-97
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000906
Family Cold shock DNA-binding domain-like 0.00066
Further Details:      
 
Domain Number 2 Region: 119-164
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000227
Family Retrovirus zinc finger-like domains 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000059027   Gene: ENSRNOG00000025938   Transcript: ENSRNOT00000064466
Sequence length 246
Comment pep:novel chromosome:Rnor_5.0:20:52098670:52175804:-1 gene:ENSRNOG00000025938 transcript:ENSRNOT00000064466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGAGKGEEPEKLPELAEDESQVLRGTGHCKWFNVRMGFGFISMISREGNPLDIPVDVF
VHQSKLFMEGFRSLKEGEPVEFTFKKSPKGLESIRVTGPGGNPCLGSERRPKGKTLQKRK
PKADRCYNCGGLDHHAKECGLPPQPKKCHYCQSIMHMVANCPHKLVAQLPASAQGRPEAE
SQPCTSPSPREVGGGHGCTVPFPQEVTSEMAEQSDRSPQEVSATKAFAAIGEQNKKGPLI
QKRKKT
Download sequence
Identical sequences ENSRNOP00000059027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]