SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000059210 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000059210
Domain Number 1 Region: 101-570
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.81e-106
Family HD domain 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000059210
Domain Number - Region: 39-102
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0424
Family SAM (sterile alpha motif) domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000059210   Gene: ENSRNOG00000006418   Transcript: ENSRNOT00000067748
Sequence length 607
Comment pep:known_by_projection chromosome:Rnor_5.0:3:158468734:158501733:1 gene:ENSRNOG00000006418 transcript:ENSRNOT00000067748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRPDSEQPAKRSRCDGSPRTPPSTRPAAANESADPESSDLRTWGPEDVCSFLEKRGFRE
KKVLDIFRGGSSLNGADDLELLISLEQRKKMIECIQKLNQSRIDLMKVFNDPIHGHIEFH
PLLIRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVRALAEKQPEL
QISERDMLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPDIKWRHEQGSVEMFEHLVNSNE
LKLVMKNYGLVPEEDITFIKEQIMGPPVSPVKDCLWPYKGRPAKKSFLYEIVANKRNGID
VDKWDYFARDCHHLGIQNNFDYKRFIKFARICEVDDETRAHKVKHICTREKEVGNLYDMF
HTRNCLHRRAYQHKIGNLIDIMITEAFLKADPHVEITGTEGKKFRISTAIHDMEAFSKLT
DNIFLEILYSTDPQLSEARNILRNIECRNLYKYLGETQPKREKIKKAEYDKLAQEVANAK
PEIAPDVELKAEDFIVDVINMDYGMEDKNPIDNVHFYCKSDSRQAVTITKDQVSQLLPQK
FAEQLIRVYYKKKDKKSLDAAGKHFIQWCALRDFTKPQSPGKGLATLPEDPGSIPSNQQP
HAARNQL
Download sequence
Identical sequences ENSRNOP00000059210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]