SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000059245 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000059245
Domain Number 1 Region: 712-781
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.09e-19
Family TB module/8-cys domain 0.0007
Further Details:      
 
Domain Number 2 Region: 2097-2169
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.27e-19
Family TB module/8-cys domain 0.0005
Further Details:      
 
Domain Number 3 Region: 1447-1518
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.15e-18
Family TB module/8-cys domain 0.00043
Further Details:      
 
Domain Number 4 Region: 1812-1883
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.24e-18
Family TB module/8-cys domain 0.0000985
Further Details:      
 
Domain Number 5 Region: 1890-2024
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.08e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 80-146
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.44e-17
Family TB module/8-cys domain 0.0017
Further Details:      
 
Domain Number 7 Region: 486-616
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.2e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 8 Region: 296-420
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.98e-17
Family Growth factor receptor domain 0.0061
Further Details:      
 
Domain Number 9 Region: 1608-1733
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.24e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 10 Region: 2212-2340
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.02e-17
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 11 Region: 209-339
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.47e-17
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 12 Region: 788-918
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.38e-16
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 13 Region: 607-691
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.16e-16
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 14 Region: 412-484
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000275
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 15 Region: 1287-1360
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000288
Family TB module/8-cys domain 0.0000472
Further Details:      
 
Domain Number 16 Region: 1079-1213
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000314
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 17 Region: 1170-1297
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000549
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 18 Region: 954-1096
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000659
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 19 Region: 1982-2099
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000706
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number 20 Region: 2337-2453
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000832
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 21 Region: 1366-1421
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000265
Family EGF-type module 0.00064
Further Details:      
 
Domain Number 22 Region: 1773-1826
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000118
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 23 Region: 2168-2217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000279
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 24 Region: 918-966
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000305
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 25 Region: 1525-1580
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000268
Family EGF-type module 0.0024
Further Details:      
 
Domain Number 26 Region: 38-85
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 27 Region: 1-54
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000101
Family EGF-type module 0.01
Further Details:      
 
Domain Number 28 Region: 1735-1786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000469
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 29 Region: 1568-1606
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000659
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000059245
Domain Number - Region: 2547-2594
Classification Level Classification E-value
Superfamily Cadherin-like 0.0012
Family Cadherin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000059245   Gene: ENSRNOG00000043219   Transcript: ENSRNOT00000066548
Sequence length 2633
Comment pep:known chromosome:Rnor_5.0:18:52284517:52414950:-1 gene:ENSRNOG00000043219 transcript:ENSRNOT00000066548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVNECDLNPNICMFGECENTKGSFICHCQLGYSVKKGATGCTDIDECSVVPGICETGDCS
NTVGSYFCLCPRGFVTSTDGSRCIDQRTGTCFSGLVNGRCAQELPGRMAKAQCCCEPGRC
WGIGTIPEACPVRGSEEYRRLCLDGLPMGGIPGSSVSRPGGSGGNSNGYGPGGTGFLPIP
GGNGFSPGVGGAGVGAGGQGPIITGLTILNQTIDICKHHANLCLNGRCIPTVSSYRCECN
MGYKQDANGDCIDVDECTSNPCSHGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQN
GVLCKNGRCVNTDGRFQCICNAGFELTTDGENCVDHDECTTTNMCLNGMCINEDGSFKCV
CKPGFVLAPNGRYCTDVDECQTPGICMNGHCINNEGSFRCDCPPGLAVGVDGRVCVDTHM
RSTCYGEIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSGGVGI
TVDGRDINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCD
NGLCRNTPGSYSCTCPPGYVFRTETETCEDVNECESNPCVNGACRNNLGSFHCECSPGSK
LSSTGLICIDSLKGTCWLNIQDNRCEVNINGATLKSECCATLGTAWGSPCERCELDAACP
RGFARIKGVTCEDVNECEVFPGVCPNGRCVNNKGSFHCECPEGLTLDGTGRVCLDVRMEH
CFLKWDEDECVHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGPGFANRG
DILTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRIS
PDLCGSGICVNTPGSFDCECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQ
CDCPLGHELSPSREDCIDINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCSD
IDECMIMNGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNI
PGEYRCLCYDGFMASMDMRTCIDVNECDLNPNICMFGECENTKGSFICHCQLGYSVKKGA
TGCTDVDECEIGAHNCDMHASCLNVPGSFKCSCREGWVGNGIKCIDLDECSNGTHQCSIN
AQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTP
ASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINC
VNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEVGVGVS
RSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQ
GGNCINTFGSFQCECPQGYYLSEETRICEDIDECFAHPGVCGPGTCYNTLGNYTCICPPE
YMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTP
GTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYN
DLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNV
CSHGLCVDLQGSYQCICNNGFKASQDQTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPG
FELTHNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIEDTNECV
ALPGSCSPGTCQNLEGSFRCICPPGYEVKSENCIDINECDEDPNICLFGSCTNTPGGFQC
ICPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCE
LCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMG
YNLDYSGVRCVDTDECSIGNPCGNGTCANVIGSFECNCNEGFEPGPMMNCEDINECAQNP
LLCAFRCMNTFGSYECTCPVGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMC
ICPPGMARRPDGEGCVDENECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDN
RQGLCFAEVLQTMCQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGP
GYATDGRDIDECKVMPSLCTNGQCVNTMGSFRCFCKVGYTTDISGTACVDLDECSQSPKP
CNFICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPG
FTQHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDASGLNCEDVDECDGN
HRCQHGCQNILGGYRCGCPQGYVQHYQWNQCVDENECSNPGACGSASCYNTLGSYKCACP
SGFSFDQFSSACHDVNECSSSKNPCSYGCSNTEGGYLCGCPPGYFRVGQGHCVSGMGFNK
GQYLSVDSEAEDDENALSPEACYECKINGYAKKDGRRKRSAPEPEPASAEEQISLESVAM
DSPVNMKFNLSGLGSKEHILELVPAIEPLNNHIRYVISQGNDDGVFRIHQRNGLSYLHTA
KKKLTPGTYTLEITSVPLYGKKELRKLEERNEDSYLLGVLGEALRMRLQIQLY
Download sequence
Identical sequences ENSRNOP00000059245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]