SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000059445 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000059445
Domain Number 1 Region: 25-127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000324
Family V set domains (antibody variable domain-like) 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000059445   Gene: ENSRNOG00000043066   Transcript: ENSRNOT00000064284
Sequence length 130
Comment pep:novel chromosome:Rnor_5.0:10:103297070:103299640:-1 gene:ENSRNOG00000043066 transcript:ENSRNOT00000064284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHLSRVILCSWWCWCSSCSTAQGSLTGPEEVSSQEQGSLTVQCQYASCWKDYGEFWCQGA
SWRTCEFIQTNKPEQLVKENCVSIRDNQTNFIFTVTMEDLRMSDADIYWCEIMRVGYDHL
FKVCVSIDSG
Download sequence
Identical sequences ENSRNOP00000059445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]