SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000059533 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000059533
Domain Number 1 Region: 2-52,102-137
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.83e-27
Family Inhibitor of apoptosis (IAP) repeat 0.0000655
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000059533   Gene: ENSRNOG00000043311   Transcript: ENSRNOT00000068252
Sequence length 163
Comment pep:known chromosome:Rnor_5.0:3:180150702:180153009:1 gene:ENSRNOG00000043311 transcript:ENSRNOT00000068252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQQDKVRCFFCYGGLQSWERGDDPWTEHARWFPRCQFLLRSKGRDFVERIQAYTPLLGSW
EQREEQEDTVSATPSAPTHGSPELLRSRRETQSEDASEPGAEDVQEQLRQLQEERRCKVC
LDRAVSVVFVPCGHFVCTECAPNLRLCPICRVPICNCVRTFLS
Download sequence
Identical sequences ENSRNOP00000059533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]