SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000059684 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000059684
Domain Number 1 Region: 83-413
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.84e-137
Family Myotubularin-like phosphatases 0.0000000547
Further Details:      
 
Domain Number 2 Region: 8-73
Classification Level Classification E-value
Superfamily PH domain-like 0.000000027
Family GRAM domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000059684   Gene: ENSRNOG00000011420   Transcript: ENSRNOT00000065327
Sequence length 419
Comment pep:known chromosome:Rnor_5.0:16:54469056:54560062:1 gene:ENSRNOG00000011420 transcript:ENSRNOT00000065327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHIRTPKILHSQISTIEKQATTATGCPLLIRCKNFQIVQLVIPQERDCHDVYVSLIRLA
RPVRYEELYCFSFNPKLDKEEREQGWLLVDLSEEYKRMGLPDNYWQLSDVNRDYRVCDSY
PTELYVPRSATAHIIVGSSKFRSRRRFPALSYYCKESHASICRSSQPLSGFSARCLEDEQ
MLQAIRKANPRSDFIYVVDTRPKLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMRN
SLQKMLEVCELKSPSMSDFLWGLENSGWLRHIKAIMDAGIFIAKAVSEEGTSVLVHCSDG
WDRTAQVCSVASLLLDPYYRTLKGFMVLIEKDWISFGHKFNHRYGNLDGDPKEISPVIDQ
FIECVWQLMEQFPCAFEFNERFLIHIQHHVYSCQFGNFLCNSQKERRELNENGKRVHSS
Download sequence
Identical sequences D3ZTB0
NP_001100782.1.100692 NP_001100782.1.4139 ENSRNOP00000059684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]