SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000059778 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000059778
Domain Number - Region: 87-149
Classification Level Classification E-value
Superfamily Globin-like 0.0158
Family Globins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000059778   Gene: ENSRNOG00000046783   Transcript: ENSRNOT00000064279
Sequence length 150
Comment pep:novel chromosome:Rnor_5.0:9:22455121:22459404:1 gene:ENSRNOG00000046783 transcript:ENSRNOT00000064279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLSVMLFLITLLFPLMSTEGRVLPQTQKESTISSNHKTNHKAALHKTDSQGEGNIQGR
EKVICASNQEQVLCGDFTNANQRKLNLSQNIMSQRTYCTQNHKVDPGCFKHKANRLQGTR
VRHQGDSFRYNILECFYKCLDLVKKVLISH
Download sequence
Identical sequences F1LSJ7
ENSRNOP00000059778 XP_017452384.1.100692 XP_017459253.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]