SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000059877 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000059877
Domain Number 1 Region: 123-239
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-34
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 2 Region: 278-343
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000264
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 3 Region: 234-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000151
Family EGF-type module 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000059877   Gene: ENSRNOG00000005348   Transcript: ENSRNOT00000064282
Sequence length 357
Comment pep:known chromosome:Rnor_5.0:3:99054239:99145372:1 gene:ENSRNOG00000005348 transcript:ENSRNOT00000064282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELDRWAQLGLAFLQLLLISSLPREYTVINEACPGAEWNIMCRECCEYDQIECICPGKKE
VVGYTIPCCRNEDNECDSCLIHPGCTIFENCKSCRNGSWGGTLDDFYVKGFYCAECRAGW
YGGDCMRCGQVLRASKGQILLESYPLNAHCEWTIHARPGFIIQLRFSMLSLEFDYMCQYD
YVEVRDGDNSDSPLIKRLCGNERPAPIRSTGSSLHVLFHSDGSKNFDGFHAAFEEITACS
SSPCFHDGTCILDTTGSFKCACLAGYTGPRCENLLEERNCSDLGGPVNGYKKITGGPGLL
NERHVKIGTVVSFFCNGSYVLSGNEKRTCQQNGEWSGKQPVCMKGKLTVISGFYRCI
Download sequence
Identical sequences NP_001101225.1.100692 NP_001101225.1.4139 ENSRNOP00000059877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]