SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000060109 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000060109
Domain Number 1 Region: 424-536
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.01e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00045
Further Details:      
 
Domain Number 2 Region: 545-639
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.23e-17
Family Ankyrin repeat 0.0016
Further Details:      
 
Domain Number 3 Region: 2-103
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.84e-17
Family G proteins 0.0000331
Further Details:      
 
Domain Number 4 Region: 210-275,364-409
Classification Level Classification E-value
Superfamily PH domain-like 6.77e-17
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000060109   Gene: ENSRNOG00000019476   Transcript: ENSRNOT00000065720
Sequence length 669
Comment pep:known chromosome:Rnor_5.0:9:96438897:96719918:1 gene:ENSRNOG00000019476 transcript:ENSRNOT00000065720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVDAVIFVFSLEDEISFQTVYHYYSRMANYRNTSEIPLVLVGTQDAISSTNPRVIDDVR
ARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPSHSS
VCSAQVSAVHISQTSNGGGSLSDYSSSVPSTPSTSQKELRIDVPPTANTPTPVRKQSKRR
SNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQGMLLKRSGKSLNKEWKKKYVTLCD
NGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRATSACAPISSPKTNGLAKDMSS
LHISPNSGKLTAASGSQMASGISLVSFNSRPDGMHQRSYSVSSADQWSDATVIANSAISS
EQEENLEFIIVSLTGQTWHFEATTYEERDAWVQAIESQILASLQSCESSKNKSRLTSQSE
AMALQSIRNMRGNSHCVDCDTQNPNWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDD
WPMELIKVMSSIGNELANSVWEEGSQGRTKPSLDSTREEKERWIRAKYEQKLFLAPLPCT
EFSLGQQLLHATAEEDLRTVILLLAHGSRDEVNETCGEGDGRTALHLACRKGNVVLVQLL
IWYGVDVMARDAHGNTALAYARQASSQECIDVLLQYGCPDERFVLMATPNLSRKNNSRNN
SSGRAPSVI
Download sequence
Identical sequences G3V9U1
NP_001101700.1.100692 NP_001101700.1.4139 ENSRNOP00000060109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]