SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000060834 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000060834
Domain Number 1 Region: 526-846
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 6.63e-104
Family PDEase 0.000000594
Further Details:      
 
Domain Number 2 Region: 312-503
Classification Level Classification E-value
Superfamily GAF domain-like 7.63e-48
Family GAF domain 0.000029
Further Details:      
 
Domain Number 3 Region: 153-304
Classification Level Classification E-value
Superfamily GAF domain-like 1.33e-20
Family GAF domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000060834   Gene: ENSRNOG00000011310   Transcript: ENSRNOT00000067142
Sequence length 849
Comment pep:known chromosome:Rnor_5.0:1:53617430:53846125:-1 gene:ENSRNOG00000011310 transcript:ENSRNOT00000067142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAGCLPITFKGGSKGPALLALRNRTDSRGQMSNDSPEGAVGSCNATGSTGSTGELGKEFH
TPPRRKSASDSRLALCMGLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRKNNKAE
DEPSPKEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNHLLLYELSSIIRIATKADGFALY
FLGECNNSLCVFTPPGMKEGQPRLIPAGPITQGTTISAYVAKSRKTLLVEDILGDERFPR
GTGLESGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWASVAIH
QVQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHK
NKELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNRE
VDLYTGYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCA
NMYHRIRHSECIYRVTMEKLSYHSICTSEEWQGLMHFNLPARICRDIELFHFDIGPFENM
WPGIFVYMIHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNN
GLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQL
EGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLHNQSHRDRV
IGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKRDEVPQG
QLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLNQWEKVIRGEETAMWISGPATSKSTS
EKPTRKVDD
Download sequence
Identical sequences ENSRNOP00000060834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]