SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000060854 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000060854
Domain Number 1 Region: 67-332
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.03e-38
Family Eukaryotic proteases 0.00046
Further Details:      
 
Domain Number 2 Region: 20-60
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000614
Family EGF-type module 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000060854   Gene: ENSRNOG00000019700   Transcript: ENSRNOT00000064694
Sequence length 332
Comment pep:known chromosome:Rnor_5.0:16:81271366:81279598:-1 gene:ENSRNOG00000019700 transcript:ENSRNOT00000064694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAFPQAQDEFWSQYSGGFPCISQPCLNNGTCKDHIRSFSCTCAPGYEGKTCAMAKNECH
LERTDGCQHFCHPGQSSYMCSCAKGYKLGEDHRSCSPSDKCACGALTSQHIRTQMTDDIC
RSWPSFPWQVRLTNSEGEDFCAGVLLQENFVLTTAKCSLLHSNLSVKADDDQQIRIKSAH
VHMRYDKETGENDVSLLELEKPLQCPIPALPVCVPERDFAEHVLIPGTKGVLSGWMLNGI
DLDRTLTMLSVTQTDGEECGQILNVTVTTRTSCEKGSEVMGPWVEGSVVTRQHKGTWFLT
GILSSPPPPGQSHMLLLTSVPRYSMWFNQIMK
Download sequence
Identical sequences ENSRNOP00000060854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]