SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000060978 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000060978
Domain Number - Region: 116-145
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00251
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000060978   Gene: ENSRNOG00000018719   Transcript: ENSRNOT00000064662
Sequence length 451
Comment pep:known chromosome:Rnor_5.0:3:66477815:66507826:-1 gene:ENSRNOG00000018719 transcript:ENSRNOT00000064662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKSFANFMCKKDFHPASKSNIKKVWMAEQKISYDKKKQEELMQQYLKEQESYDNRLLMG
DERVKNGLNFMYEAPPGVKKENKEKEETEGETEYKFEWQKGAPREKYAKDDMNIRDQPFG
IQVRNVRCIKCHKWGHVNTDRECPLFGLSGINASSVPTDGSGPSMHPSELIAEMRNSGFA
LKRNVLGRNLTANDPSQDYVASDGEEDPEVEFLKSLTTKQKQKLLRKLDRLEKKKKKKKS
DKKKKKLQKSKNKHKKHKKSSSSSSSSSSSSSSSSSSSSSSSSSSTSSSETDSSSESDNK
EKKEKEKRKKRKKTKCSGNKSGDCKEYKSKNMLYEELSSSHSDRGKAQEKLRLLKQESSG
ENSTWVHSGSDRKSRSHQHSPERKGSDRNGGSRSRSRAEGSRRSRSRSPCGQKHREREAR
SRPHQSPSEEQKGRKGTRSHGDSEHRRERAR
Download sequence
Identical sequences Q5U2T8
ENSRNOP00000060978 NP_001007800.1.100692 NP_001007800.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]