SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000061084 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000061084
Domain Number 1 Region: 264-559
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-49
Family p120GAP domain-like 0.00068
Further Details:      
 
Domain Number 2 Region: 112-240
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.16e-32
Family Synaptotagmin-like (S variant) 0.0024
Further Details:      
 
Domain Number 3 Region: 519-662
Classification Level Classification E-value
Superfamily PH domain-like 3.75e-32
Family Pleckstrin-homology domain (PH domain) 0.0033
Further Details:      
 
Domain Number 4 Region: 6-128
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.49e-27
Family Synaptotagmin-like (S variant) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000061084   Gene: ENSRNOG00000001431   Transcript: ENSRNOT00000064405
Sequence length 757
Comment pep:known chromosome:Rnor_5.0:12:25597617:25624562:-1 gene:ENSRNOG00000001431 transcript:ENSRNOT00000064405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRSSLSIRIVEGKNLPAKDITGSSDPYCIVKVDNEPIIRTATVWKTLCPFWGEEYQVH
LPPTFHMVAFYVMDEDALSRDDVIGKVCLTRDELTSHPKGFIGWTHLVEVDPNEEVQGEI
HLRLEVVPGLHASRLRCSVLEARDLAPKDRNGASDPFVRVHYNGRTQETSVVKKSCYPRW
NETFEFELEKGATEALLVEAWDWDLVSRNDFLGKVVVNVQTLCSAQQEEGWFRLQPDQSK
SRQGKGNLGSLQLEVRLRDETVLPSVYYQPLVQLLCQEVKLGTQGPGQLIPVIEETTSAE
CRQEVATTLLKLFLGQGLAKDLLDLLFQLELGRTSEANTLFRSNSLASKSMESFLKVAGM
RYLHGILGPIIDRVFEEKKYVELDPSKVEVKDVGCSGLHRPQTEAEVLEQSAQTLRAHLV
ALLSAICRSVRTCPAVVRATFRQLFRRVRERFPSAQHQAVQNIGNMDTPVSRAKESWMEP
LQPTVRQGVVQLKDFITKLVDIEEKEELDLQRALNLQAPPVKEGPLFIHRTKGKGPLASS
SFKKLYFSLTTEALSFAKTSSSKKSVFIKLASIRAAEKVEEKSFGSSHVMQVIYSDDVGR
AQTVYLQCKCVNELNQWLSALRKVITNNASLLGSYHPGVFRGDKWSCCHQKEKTDLGCDK
THSRVTLQEWNDPLDHDLEAQLIYRHLLGVEAALREKHQLLSRATEEAGTSSTGRGGAPE
DSLAQLLRVLRDLREAHSSSLASSPSREPRHLLELQT
Download sequence
Identical sequences D4A166
ENSRNOP00000061084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]