SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000061212 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000061212
Domain Number 1 Region: 35-56,84-620,656-668
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 1.02e-140
Family Prokaryotic type I DNA topoisomerase 0.0000428
Further Details:      
 
Domain Number 2 Region: 645-688
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000116
Family PhnA zinc-binding domain 0.065
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000061212
Domain Number - Region: 976-1001
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0146
Family Retrovirus zinc finger-like domains 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000061212   Gene: ENSRNOG00000005099   Transcript: ENSRNOT00000068351
Sequence length 1003
Comment pep:known_by_projection chromosome:Rnor_5.0:10:46754952:46790713:-1 gene:ENSRNOG00000005099 transcript:ENSRNOT00000068351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFPVTLLAFQWQRRPGGRALSRAAMEVAFRGVRKVLCVAEKNDAAKGIADLLSNGRMRR
KEGLSKFNKIYEFDYHLYGQNVTMIMTSVSGHLLAHDFQMQFRKWQSCNPLVLFEAEIEK
YCPENFIDIKKTLERETQHCQALVIWTDCDREGENIGFEIIHVCKAVKPNLQVLRARFSE
ITHHAVRAACEHLTEPDQRVSDAVDVRQELDLRIGAAFTRFQTLRLQRIFPEVLAEQLIS
YGSCQFPTLGFVVERFKAIQAFVPEVFHRIKVTHDHKDGTVEFNWKRYRLFNHTACLVLY
QLCMEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRINAKETMRIAEKLYTQGVS
QQPAHLGIVLPDGVLLSDLNSIPSTHIHSGSLPSLTSIPGDPMLTSERQTDGTQIPIHPT
KYTSSLQGDDRRLYEFIVRHFLACCSQDAQGQETTVEIDIAQERFVAHGLIILARNYLDV
YPYDHWSDKLLPVYEQGFRFQPSTVEMVDGETSPPQLLTEADLIALMEKHGIGTDATHAE
HIETIKARMYVGLTSDKRFLPGHLGMGLVEGYDSMGYEMSKPNLRAELEADLKLICEGKK
DKFQVLRQQVQKYKQVFIEAVAKAKKLDEALSQYLGERTEVAQQEEIYPAMPEPVRKCPQ
CNKDMVLKTKKSGGFYLSCTGFPECRSAVWFPDSVLEASRDSSVCSVCQPAPVYRLKLKF
KRGSLPPSMPLEFVGCIGGCDETLKEIFGLRFSRAPPRASQPSGHLQASQALNRMDSSQR
SLSQPLVNRHTGPSKAVAQTLLPPTAAAEGNSVTCNCGREAVLLTVRKQGPNQGRHFYKC
SGGDCNFFLWADSSHPTGGGPPTSVSRPPGNSVGCPSGFGSHMDGFGSLGGDGDGGASCL
CGQPAVTRTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENMAPGSFAAPAWPGGRGKAQ
RPEAASKRQRAGSLDAGSTVKKPRKCSLCHQPGHTRPFCPQNR
Download sequence
Identical sequences ENSRNOP00000061212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]