SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000061284 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000061284
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.96e-29
Family Ubiquitin-related 0.0000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000061284   Gene: ENSRNOG00000019895   Transcript: ENSRNOT00000064916
Sequence length 81
Comment pep:known chromosome:Rnor_5.0:15:38230806:38242650:-1 gene:ENSRNOG00000019895 transcript:ENSRNOT00000064916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK
ILGGSVLHLVLALRGGGGLGQ
Download sequence
Identical sequences A0A1U8CYD2 G3HDD4 P29595 Q3UI46 Q71UE8
ENSRNOP00000061284 ENSRNOP00000061284 NP_032709.1.92730 NP_620233.1.100692 NP_620233.1.4139 XP_003502102.1.69978 XP_007609234.1.28591 XP_008838027.1.79516 XP_012980364.1.91757 XP_021058637.1.100879 XP_021506009.1.76796 ENSMUSP00000010520 ENSMUSP00000010520 ENSMUSP00000010520 ENSMUSP00000130492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]