SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000061365 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000061365
Domain Number 1 Region: 288-682
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.44e-121
Family Oxysterol-binding protein 0.0011
Further Details:      
 
Domain Number 2 Region: 4-65
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000858
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000061365   Gene: ENSRNOG00000021057   Transcript: ENSRNOT00000065411
Sequence length 682
Comment pep:known chromosome:Rnor_5.0:1:235460266:235490067:1 gene:ENSRNOG00000021057 transcript:ENSRNOT00000065411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHTCRGTINLATANITVEDSCNFIISNGGAQTYHLKASSEVERQRWVTALELAKAKAVK
MLAESDESGDEESVSQTDKTELQNTLRTLSSKVEDLSTCNDLIAKHGTALQRSLSELESL
KLPAESNEKIKQVNERATLFRITSNAMINACRDFLMLAQTHSKKWQKSLQYERDQRIRLE
ETLEQLAKQHNHLERAFRGATVLPANTPGSTGSGKEQCCSGKGDMSDEDDENEFFDAPEI
ITMPENLGHKRTGSNISGASSDISLDEQYKHQLEETKKEKRTRIPYKPNYSLNLWSIMKN
CIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDRAAKCENSLEQLCYVAAFTVSSYS
TTVFRTSKPFNPLLGETFELDRLEENGYRSLCEQVSHHPPAAAHHAESKNGWTLRQEIKI
TSKFRGKYLSIMPLGTIHCIFHATGHHYTWKKVTTTVHNIIVGKLWIDQSGEIDIVNHKT
GDKCNLKFVPYSYFSRDVARKVTGEVTDPSGKVHFALLGTWDEKMDCFKVQPASGENGGD
ARQRGHEAEESRVMLWKRNPLPKNAENMYYFSELALTLNAWEGGTAPTDSRLRPDQRLME
NGRWDEANAEKQRLEEKQRLSRKKREAEAMKATEDGTPYDPYKALWFERKKDPVTKELTH
VYRGEYWECKEKQDWGSCPDIF
Download sequence
Identical sequences D4A9D8
NP_001102397.1.100692 NP_001102397.1.4139 ENSRNOP00000061365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]