SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000061387 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000061387
Domain Number 1 Region: 394-537
Classification Level Classification E-value
Superfamily PH domain-like 8.3e-39
Family Third domain of FERM 0.00000398
Further Details:      
 
Domain Number 2 Region: 290-395
Classification Level Classification E-value
Superfamily Second domain of FERM 3.4e-36
Family Second domain of FERM 0.000000871
Further Details:      
 
Domain Number 3 Region: 209-289
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.55e-26
Family First domain of FERM 0.00000862
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000061387   Gene: ENSRNOG00000010037   Transcript: ENSRNOT00000067349
Sequence length 820
Comment pep:known_by_projection chromosome:Rnor_5.0:5:153762345:153894181:-1 gene:ENSRNOG00000010037 transcript:ENSRNOT00000067349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEKSLAAEAENSQHQKEEGEGATNSGQQESQLEEASQAAAAEGSNQGEQKLKASNGDT
PTHEDLTKNKERTSESRGLSRLLSSFLKRPKSQVSEEEGREVESEREKGEGEQKETELGT
SLDEDVILKAPIAAPEPELKTDPSLDLHSLSSIETQPAQEEHREDPDSETKEGEGIEECS
GTEVKEDPESRAEREPETSQKPIRRHRNMHCKVSLLDDTVYECVVEKHAKGQDLLKRVCE
HLNLLEEDYFGLAVWDSTTSKTWLDSAKEIKKQVRGVPWNFTFNVKFYPPDPAQLTEDIT
RYYLCLQLRQDIVAGRLPCSFATLALLGSYTVQSELGDYDPELHGVDYVSDFKLAPNQTR
ELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGLL
VYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQEHYESTIGFKLPSYRAAKKLWKVCV
EHHTFFRLTSTDTLPKSKFLALGSKFRYSGRTQAQTRQASALIDRPAPHFERTASKRASR
SLDGAAAAESTDRSPRPTSAPAIAQSQVMEGPGAPAKKAPKEAVKVEEKRGEEPAEPEPE
PTEAWKVEKPHTEVTVPTSNGDQAQDLDKSQEEIKKHHASISELKKNFMESVPEPRPSEW
DKRLSTHSPFRTLNINGQVPTGDGPPLVKTQTVTISDTANAVKSEIPTKDVPIVHTETKT
ITYEAAQTEDSNGDLDPGVLLTAQTITSETTSSTTTTQITKTVKGGISETRIEKRIVITG
DADIDHDQVLVQAIKEAKEQHPDMSVTKVVVHQETEISEE
Download sequence
Identical sequences D4A9A6
ENSRNOP00000061387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]