SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000061547 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000061547
Domain Number 1 Region: 43-142,239-354
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.71e-25
Family FAD/NAD-linked reductases, N-terminal and central domains 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000061547   Gene: ENSRNOG00000000172   Transcript: ENSRNOT00000068129
Sequence length 450
Comment pep:known chromosome:Rnor_5.0:3:121438451:121477299:1 gene:ENSRNOG00000000172 transcript:ENSRNOT00000068129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLVAVVSSPRARLFACFLRLGTQQAGPLQLHTGACCTAKNHYEVLVLGGGSGGITMAT
RMKRRVGAENVAIVEPSERHFYQPIWTLVGAGAKELSSSDRSTLSVIPSGVQWIQDRVAE
LNPDQNCIRTDNGKEISYRYLIIALGIQLDYEKIKGLPEGFAYPKIGSNYSVKTVEKTWK
ALQDFKEGNALFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTALGTIFGVK
KYADALQEIIRERNVSVNYKHNLIEVRADKQEAVFENLDKPGETHVIHYEMLHVTPPMSS
PDVLKRSPVADSAGWVDVDKETLQHKKYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTI
SLIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYTAQPLETFPFDQSKERISMYLMKAD
MMPFLYWNMMLRGYWGGPAFLRKLFHLGLS
Download sequence
Identical sequences B0BMT9
ENSRNOP00000061547 NP_001041378.2.100692 NP_001041378.2.4139 XP_006234949.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]