SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000061704 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000061704
Domain Number 1 Region: 1-69
Classification Level Classification E-value
Superfamily Lysozyme-like 3.75e-29
Family C-type lysozyme 0.000039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000061704   Gene: ENSRNOG00000005825   Transcript: ENSRNOT00000064784
Sequence length 117
Comment pep:known chromosome:Rnor_5.0:7:60340639:60343246:-1 gene:ENSRNOG00000005825 transcript:ENSRNOT00000064784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGYYGVSLADWVCLAQHESNYNTQARNYNPGDQSTDYGIFQINSRYWCNDGKTPRAKNA
CGIPCSGAFCTLSCSHREEFETPAKERHSQPGNCEHPLKWKPLGNAPAECQSCCPYM
Download sequence
Identical sequences ENSRNOP00000061704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]