SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000062123 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000062123
Domain Number 1 Region: 991-1159
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-43
Family C-type lectin domain 0.00000539
Further Details:      
 
Domain Number 2 Region: 149-266
Classification Level Classification E-value
Superfamily C-type lectin-like 1.2e-38
Family Link domain 0.0016
Further Details:      
 
Domain Number 3 Region: 269-359
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-28
Family Link domain 0.0031
Further Details:      
 
Domain Number 4 Region: 1160-1218
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000834
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 5 Region: 43-156
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000635
Family V set domains (antibody variable domain-like) 0.022
Further Details:      
 
Domain Number 6 Region: 956-998
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000371
Family EGF-type module 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000062123   Gene: ENSRNOG00000048036   Transcript: ENSRNOT00000064308
Sequence length 1263
Comment pep:novel chromosome:Rnor_5.0:16:20900031:20925162:1 gene:ENSRNOG00000048036 transcript:ENSRNOT00000064308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAESVWASGLLVLWLLLLVSGDQDTQDTTTTEKGLHMLKSGSGPIQAALAELVALPCFF
TLQPRQSPLGDIPRIKWTKVQTASGQRQDLPILVAKDNVVRVAKGWQGRVSLPAYPRHRA
NATLLLGPLRASDSGLYRCQVVKGIEDEQDLVTLEVTGVVFHYRAARDRYALTFAEAQEA
CHLSSATIAAPRHLQAAFEDGFDNCDAGWLSDRTVRYPITQSRPGCYGDRSSLPGVRSYG
RRDPQELYDVYCFARELGGEVFYVGPARRLTLAGARALCQRQGAALASVGQLHLAWHEGL
DQCDPGWLADGSVRYPIQTPRRRCGGSAPGVRTVYRFANRTGFPAPGARFDAYCFRAHHH
TPQRGDSEIPSSGDEGEIVSAEGPPAPELKPRLGEQEVITPDFQEPLVSSGEDEPLDLTR
TQASQETLASTPGGPTLASWPSREKWLLTGVTSSTGVPSPSSLGVDMEETTPSGTQVAPT
PTMRRGRFKGLNGRHFQQQGPEDQLLEAAEASAQPPTLEVTADHMGPSAATEALESDQSH
SPWAILTNEVDVPGAGSLGSRSLPESRKWSPSLISPSTVPSTDSTPGLKPGADEAPGVKS
AIHHPPWLPSEPAVPSSIPSEALSAVSLQASPGDGSPDFPIVAMLRAPKLWLLPHSTLVP
NVSPIPLSPASPLPSSVPEEQAVRPVSFGAEDPETPFQTTMAAPGEASHGSPEADSIEIE
GISSMQATKHPISGPWASLDSSNVTVNPVPSDAGILGTESGVLDLPGSPTSDGQATVDKV
LATWLPLPGHGLDTGSQSTPMEAHGVTMSVEPTVALEGGATKDPMEATMDVVPSTVDATS
GSEPKSSISSTHVVVTAAGDQGTPTLTPTSSEGQVVAQESLGTLTSLPSHPWSSLASSMD
EVASVSSGEPTGLWDIPSTLIPVSLGLDESDLKVVAESPGLEGFWEEVASGQEDPTDPCE
NNPCLHGGTCRTNGTMYGCSCDQGYAGENCEIDIDDCLCSPCENGGTCIDEVNGFICLCL
PSYGGNLCEKDTEGCDRGWHKFQGHCYRYFAHRRAWEDAERDCRRRAGHLTSVHSPEEHK
FINSFGHENSWIGLNDRTVERDFQWTDNTGLQYENWREKQPDNFFAGGEDCVVMVAHENG
RWNDVPCNYNLPYVCKKGTVLCGPPPAVENASLVGVRKVKYNVHATVRYQCDEGFSQHHV
ATIRCRNNGKWDRPQIVCTKPRRSHRMRRHHHHPHRHHKPRKEHRKHKRHPAEDWEKDEG
DFC
Download sequence
Identical sequences G3V8R2
ENSRNOP00000027768 ENSRNOP00000062123 NYSGRC-IgSF-ENSRNOP00000027768 10116.ENSRNOP00000027768 ENSRNOP00000027768 NP_113841.2.100692 NP_113841.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]