SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000062187 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000062187
Domain Number 1 Region: 79-356,472-518
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.52e-43
Family FAD-linked reductases, N-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 336-459
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 6.02e-29
Family L-aminoacid/polyamine oxidase 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000062187   Gene: ENSRNOG00000018838   Transcript: ENSRNOT00000064501
Sequence length 531
Comment pep:known chromosome:Rnor_5.0:1:219493099:219518141:1 gene:ENSRNOG00000018838 transcript:ENSRNOT00000064501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYAPSWPKILTLIKVRELTSCHYTLGPPIRQDFWCLESGWVCEIKLGLGLSFNPTLTQQD
WKGRWSSLEPSAGQGFVRKRSGVVELGAHWIHGPSQGNPVFQLAAEFGLLGEKELSEENQ
LVETGGHVALPSVSCTSSGTSVSLELVTEMGSLFYGLIDRTREFLNESETPMASVGEFLK
KEISQQVANWTEDENTKRLKLAVLNTFFNIECCVSGTHSMDLVALAPFGEYTVLPGLDCT
LSGGYQGLTNCILASLPKEVMVFDKPVKTIHWNGSFQEAAFPGETFPVLVECEDGARLPA
HHVIVTVPLGFLKEHQDTFFEPPLPAKKAEAIRKLGFGTNNKIFLEFEEPFWEPDCQFIQ
VVWEDTSPLQDSPLSLQDTWFKKLIGFLVLPSFESSHVLCAFIAGLQSEFMETLSDEEVL
LSLTQVLRRVTGNPQLPAAKSVLRSRWHSAPYTRGSYSYVAVGSTGDDLDLMAQPLPADG
TGTQLQVLFAGEATHRTFYSTTHGALLSGWREADRLIGLWDSQAEQSRPRL
Download sequence
Identical sequences D3Z8W0
ENSRNOP00000062187 NP_001099781.1.100692 NP_001099781.1.4139 10116.ENSRNOP00000062187 ENSRNOP00000025482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]