SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000062667 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000062667
Domain Number 1 Region: 1374-1543,1590-1663,1727-1826
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.95e-117
Family Mammalian PLC 0.00000431
Further Details:      
 
Domain Number 2 Region: 502-723,751-849
Classification Level Classification E-value
Superfamily Ras GEF 8.63e-39
Family Ras GEF 0.0052
Further Details:      
 
Domain Number 3 Region: 2112-2223
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.79e-36
Family Ras-binding domain, RBD 0.00000161
Further Details:      
 
Domain Number 4 Region: 1986-2092
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.78e-29
Family Ras-binding domain, RBD 0.00000416
Further Details:      
 
Domain Number 5 Region: 1852-1963
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.24e-22
Family PLC-like (P variant) 0.0031
Further Details:      
 
Domain Number 6 Region: 1190-1221,1304-1362
Classification Level Classification E-value
Superfamily EF-hand 0.000000000212
Family EF-hand modules in multidomain proteins 0.044
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000062667
Domain Number - Region: 853-894,928-1005
Classification Level Classification E-value
Superfamily PH domain-like 0.00381
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000062667   Gene: ENSRNOG00000014276   Transcript: ENSRNOT00000067149
Sequence length 2281
Comment pep:known chromosome:Rnor_5.0:1:264652842:264956663:1 gene:ENSRNOG00000014276 transcript:ENSRNOT00000067149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSEEMAASFLIPVPQRKVASAQSVAEERGEKVSEAGIPKTRAGRQGGLTPRTISQRNEP
EEESPRTDFSQVFSIARGELDSDENHNERCWEENVPGSTKNHAVNCNSLLQSHQHALPPS
QLCEVCDSVTEEHLCLQPGIPSPLERKVFPGIELEMEDSPMDVSPLGNQPGIMESSGPHS
DRNMAVFHFHYAGDRTMPGAFHTLSEKFILDDCANCVTLPGGQQNKNYMAYTCKLVELTR
TCGSKNGQLKCDHCTSLRDEYLCFESSCRKAEALSSGGGFCEDGFTHGPSAKTFLNPLEE
FSDNCEDVDDIFKGKKERSTLLVRRFCKNDREVKKSVYTGTRAIVRTLPSGHIGLAAWSY
VDQKKAGLMWPCGNGMRPLSTVDVRQSGRQRLSEAQWCLIYSAVRREETEDTVGSLLHCS
TQLPTPDTAHGRIGDGPCLKQCVRDSECEYRATLQRTSIAQYITGSLLEATTSLGARSSL
LSSFGGSTGRIMLKERQPGTSMANSSPVPSSSAGISKELIDLQPLIQFPEEVASILTEQE
QNIYRRVLPMDYLCFLTRDLSSPECQRSLPRLKACISESILMSQSGEHNALEDLVMRFNE
VSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFM
DQSDIETMRSLKDAMAQHESSVEYKKVVTRALHIPGCKVVPFCGVFLKELCEVLDGASGL
LKLCPRYSSQEEALEFVADYSGQDNFLQRVGQNGLKNPEKELTVNSIFQIIRSCSRSLET
EDEESASEGSGSRKNSLKDKTRWQFIIGDLLDSDNDIFEKSKECDPHGSEESQKAFDHGT
ELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWMKPPTASPAG
ARLKLGVLSNVAEPGKFPSLGNAGVSGLVEGILDLFSVKAVYMGHPGIDIHTVCVQNKLS
SMLLSETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTTAVRKIRKFPDQRQQWL
RKQYVSFYQEDGRYEGPTLAHAVELFGGRRWSTRNPSPGMSAKNAEKPNMQRNNTLGIST
TKKKKKMLMRGESGEVTDDEMATRKAKMYRECRSRSGSDPQEANEQEDSEANVITNPPNP
LHSRRAYSLTTAGSPNLATGMSSPISAWSSSSWHGRIKGGMKGFQSFMVSDSNMSFIEFV
ELFKSFSIRSRKDLKDIFDIYSVPCNRSASESAPLYTNLTIEENTNDLQPDLDLLTRNVS
DLGLFMKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSLGIFGVGILQLNDFLVNCQGE
HCTYDEILSIIQKFEPNISMCHQGLLSFEGFARFLMDKDNFASKNDESRENKKDLQLPLS
YYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSIELDCWDGDDGMPIIYHGHTLTTK
IPFKEVVEAIDRSAFITSDLPIIISIENHCSLPQQRKMAEIFKSVFGEKLVAKFLFETDF
SDDPMLPSPDQLRRKVLLKNKKLKAHQTPVDILKQKAHQLASMQTQAFTGGNANPPPASN
EEEEDEEDEYDYDYESLSDDNILEDRPENKSCADKLQFEYNEEVPKRIKKADNSSGNKGK
VYDMELGEEFYLPQNKKESRQIAPELSDLVIYCQAVKFPGLSTLNSSGSGRGKERKSRKS
IFGNNPGRMSPGETASFNRTSGKSSCEGIRQIWEEPPLSPNTSLSAIIRTPKCYHISSLN
ENAAKRLCRRYSQKLIQHTACQLLRTYPAATRIDSSNPNPLMFWLHGIQLVALNYQTDDL
PLHLNAAMFEANGGCGYVLKPPVLWDKSCPMYQKFSPLERDLDAMDPATYSLTIISGQNV
CPSNSTGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFRVHFEDLVFLRFAVV
ENNSSAITAQRIIPLKALKRGYRHLQLRNLHNEILEISSLFINSRRMEDNPSGSTRPASL
MFNTEERKCSQTHKVTVHGVPGPEPFAVFTINEGTKAKQLLQQILAVDQDTKLTAADYFL
MEEKHFISKEKNECRKQPFQRAVGPEEDIVQILNSWFPEEGYVGRIVLKPQQETLEEKNI
VHDDREVILSSEEESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQTLCKAKYSYSILNN
PNPCDYVLLEEVMKDAPNKKSSTPKSSQRILLDQECVFQAQSKWKGAGKFILKLKEQVQA
SREDKRRGISFASELKKLTKSTKQTRGLTSPPQLVASESVQSKEEKPMGALASGDTAGYQ
S
Download sequence
Identical sequences G3V9X9
ENSRNOP00000062667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]