SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000062924 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000062924
Domain Number 1 Region: 531-699
Classification Level Classification E-value
Superfamily Sec7 domain 1.96e-56
Family Sec7 domain 0.0000569
Further Details:      
 
Domain Number 2 Region: 745-880
Classification Level Classification E-value
Superfamily PH domain-like 2.04e-28
Family Pleckstrin-homology domain (PH domain) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000062924   Gene: ENSRNOG00000013884   Transcript: ENSRNOT00000068177
Sequence length 1007
Comment pep:known chromosome:Rnor_5.0:16:23359208:23666165:1 gene:ENSRNOG00000013884 transcript:ENSRNOT00000068177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNCWSYSNLCDHGGSTLLPPTVTNEFPEYGTMEEGAEGLRASLDFDAKSPPCHLPGQQA
VHLLAGQDSVLNSVTEGPNGAPQCHPQEQSLQPIDSLISALKATEARIASGTFQATKVLD
KDANFSVHRVDKEPRTASHKPQRAHRTFPVGPGKSPDRPLSVEVPTEEKFSLHIQEDLTA
LLPEETPAQLSQITNYRRQGPLHVPESACPVSLGSAKNHNSVDRIGALKDQKSDLGRENP
RGCDRGGSMGRQTRIKHVEFQGVEILWTGEEVESRHPPPERTASPVRKEFAKGPSHSSSA
TGACSSSTHLTGSVSDETCKEPSARPGTSLGTLSPVPLGESGEDDVFLRESKEHLEENFD
IQGDKERFFKQEEHLRGGDDDILGPGYTEDSTDVYSSQFETILDNTSLYYSAESLETLYS
EPDSYFSFEMPLTPMIQQRIKEGGQFLERTSVGGHHDVLSVSADGGIVMGYSTGITNGLH
DPSNSVYTRGPQEIAFWGSSGYCFDKGKPTRLDGNSEMGSTEILEKETTENLSNGTNSNV
EAAKRLAKRLYHLDRFKRSDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFLKA
FSLVGETQERERILIHFSNRYFSCNPDTITSKDGVHCLTCALMLLNTDLHGHINNIGKKM
TCQEFITNLQGVNEGGDFSKDLLKALYNSIKNEKLEWAADDEEKKKSPSEGTDEKANGTH
PKTISRIGSTTNPFLDIPHDPNAAVYKSGFLARKIHADMDGKKTPRGKRGWKTFYAVLKG
TVLYLQKDEYKPEKSLSDEDLKNAVSVHHALASKATEYEKKPNVFKLKTADWRVLLFQTQ
SPEEMQGWINKINCVAAVFSAPPFPAAIGSQKKFSRPLLPATTTKLSQEEQLKSHESKLK
QITTELAEHRSYPPDKKVKAKDVDEYKLKDHYLDFEKTRYEIYVSILKEGGKDLLSTEGN
EPVGLKKSHSSPSLNPDASPVTAKVKRNVSERKDHRPETPGIKQKVT
Download sequence
Identical sequences ENSRNOP00000062924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]