SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000063652 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000063652
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Globin-like 1.25e-54
Family Globins 0.000000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000063652   Gene: ENSRNOG00000048955   Transcript: ENSRNOT00000066053
Sequence length 147
Comment pep:known chromosome:Rnor_5.0:1:175127946:175129363:-1 gene:ENSRNOG00000048955 transcript:ENSRNOT00000066053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHLTDAEKATVSGLWGKVNADNVGAEALGRLLVVYPWTQRYFSKFGDLSSASAIMGNPQ
VKAHGKKVINAFNDGLKHLDNLKGTFAHLSELHCDKLHVDPENFRLLGNMIVIVLGHHLG
KEFTPCAQAAFQKVVAGVASALAHKYH
Download sequence
Identical sequences A0A1K0FUA6 P11517
ENSRNOP00000048546 ENSRNOP00000063652 NP_001104739.1.100692 NP_001104739.1.4139 NP_001106694.1.100692 XP_008772023.1.100692 XP_017458001.1.100692 10116.ENSRNOP00000048546 ENSRNOP00000048546 ENSRNOP00000049976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]