SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000064069 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000064069
Domain Number - Region: 13-35
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000481
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000064069   Gene: ENSRNOG00000047506   Transcript: ENSRNOT00000074499
Sequence length 153
Comment pep:known chromosome:Rnor_5.0:7:122151954:122156372:1 gene:ENSRNOG00000047506 transcript:ENSRNOT00000074499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVPGCNKDNVQAGCRKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEESEELN
KLQALQEKRINEEEEKKKEKSREKIKLKKKRKRSNSSTTEEDSSKQKKQKYQKKEKKKEK
KNKSKKGKHHKKEKKKRKKEKRSSPNRSEVTKK
Download sequence
Identical sequences M0R3Z4
ENSRNOP00000064069 XP_006226223.1.4139 XP_006242190.1.100692 XP_008764027.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]