SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000064084 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000064084
Domain Number 1 Region: 153-243
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 8.11e-33
Family Inhibitor of apoptosis (IAP) repeat 0.0000979
Further Details:      
 
Domain Number 2 Region: 260-369
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 2.75e-31
Family Inhibitor of apoptosis (IAP) repeat 0.00025
Further Details:      
 
Domain Number 3 Region: 1032-1431
Classification Level Classification E-value
Superfamily RNI-like 1.1e-29
Family 28-residue LRR 0.061
Further Details:      
 
Domain Number 4 Region: 15-134
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 3.66e-25
Family Inhibitor of apoptosis (IAP) repeat 0.00089
Further Details:      
 
Domain Number 5 Region: 494-641
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000335
Family ABC transporter ATPase domain-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000064084   Gene: ENSRNOG00000033693   Transcript: ENSRNOT00000073781
Sequence length 1447
Comment pep:known chromosome:Rnor_5.0:2:49536673:49572335:-1 gene:ENSRNOG00000033693 transcript:ENSRNOT00000073781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQGEAFEERICEFDDDLVSEFSTLLRVDALQVLKRQQEEDHKTRMKMKKGFNAQMRSE
AKRLKTFVTYDTFRSWTPQEMAAAGFYYTGVRHGVQCFCCSLILFATRLRKVPIEVHRKL
QPECEFLSGKDVGNIGKYDIRVKSPETLPRGGRARYHEEEARLESFEDWPFYAHGTSPRV
LSAAGFVFTGKRDTVQCFSCGGCLGNWEEGDDPWKEHAKWFPKCEFLQSKKSAEEIAKYI
QTYEGFLHVTGEHFVNSWVRRELPVVSAYSNDSVFANEGLRMDTFKDWPHESPMAVEALV
KAGLFYTGKKDIVQCFSCGGCMENWKEGDDPIEDHTKFFPNCVFLQTLKSSAEVIPALQS
HCARPEAMETTSESNHEDGVAVHSSVAGKEPLERRELRPPESLERVFLRILPNSPGQGGG
FIPTCTSLPSADLGQSEAQWCQEARSLSEQLRGTYTKASFRHMNLPEAYSSLGTDHLLGC
EVFLISKHVSRPVQVALTIPEVFANLSSVMCVEGEAGSGKTTFLKRIAFLWASGCCPLLN
RFQLVFYLSLRSIRADQGLADIICAQLLEAGGCISEVSLSSGIQHLQHQVLFLLDDYSGM
DSLPQALDTLITKNYLSRTCLLMAVHTNRVRDIRPYLETVLQIKEFPFYNTVYILKKIFS
HDIIRVRRFINYFGFHEYLQGIHKTPLFVAGVCADWLQNPSDQPFQDVTIFKSYMQYLFL
KHKATAGPLQATVSSCGHLALTGLFSSSFEFSSDDLIEAGVDEDEELSTCLMSKFTAQRL
RPVYRFLSPLFQEFLAAMRLSELLGSDSQEDQDLGLYYLRQINSPLKAMSIYHTFLRYVS
NHPSSKAGPKVISHLLQLVDEKESPENTSENEDYMKLHPETLLWSQCLRGLLQLSPESFS
LFISERLLNIALNFAYQSNTVAACSPVILQFLQGRTLDLKVLNLQYFWDHPETLLLLKSI
QVLFNGNNRVQRIDFSLMDKSFEKIQPPTIDQDYAFAFQPMSECQRNLAEKENIIKNYDD
MKYQDPLNISSGYWKLSPKPYKIPRLEVGVNNMGPADQALLHVLMEVFSASQSIEFHLFN
SSGFLESIRPALELNKTSVTKCSMSRLELSRAEQELLLTLPALQSLEVSGTSQIPDQLFH
NLDKFLGLKELSVRLDGTQDMLSVLPGEFPNLHHMEKLSIHTSTESDLSKLVKLIQNSPN
LHDFHLKCDFLSNCESLMAALASCKKLREIEFSGRCFEAVPFVNILSNFASLKILNLRNQ
QFPDKETSEKFAQALGSLRNLEELHLPTGDGIHQVAKPIVRRCLQLPCLRVLVFAETLDD
DSVLEIAKGATSGGFQNLENLDLTLNHKITEEGYRNFFQALDNLPNLQNLDISRHIPECI
QVQASTVKALGQCVSRLPSLTRLGMLSWLLDEEDMKVINDVKERHPQSKRLTVHWRWVVP
FSPVIQK
Download sequence
Identical sequences ENSRNOP00000064084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]