SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000064242 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000064242
Domain Number 1 Region: 774-983
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.72e-49
Family DBL homology domain (DH-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 1016-1214
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.94e-45
Family BAR domain 0.0024
Further Details:      
 
Domain Number 3 Region: 244-312
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-18
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 4 Region: 1516-1578
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-17
Family SH3-domain 0.0000245
Further Details:      
 
Domain Number 5 Region: 1281-1357
Classification Level Classification E-value
Superfamily SH3-domain 5.78e-16
Family SH3-domain 0.0000104
Further Details:      
 
Domain Number 6 Region: 143-204
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000171
Family SH3-domain 0.0009
Further Details:      
 
Domain Number 7 Region: 3-62
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000407
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 8 Region: 68-137
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000158
Family SH3-domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000064242   Gene: ENSRNOG00000050742   Transcript: ENSRNOT00000074810
Sequence length 1581
Comment pep:known_by_projection chromosome:Rnor_5.0:1:271071975:271134597:-1 gene:ENSRNOG00000050742 transcript:ENSRNOT00000074810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGSVVRAIFDFCPSVSEELPLFVGDVIEVLTVVDEFWLLGKKEDVTGQFPSSFVEIVT
IPSLKEGERLFVCTCDFISREPNSLSLHRGDLVIIDGTPTAGWLQGRSSLGARGFFPSSC
IHELCLSSQSRQWHSQNMLLQVPEYSMGQARALMGLSAQLDEELDFREGDVITIIGVPEP
GWFEGELEGRRGIFPEGFVELLGPLRTADESVNAGSGDDSTLNDEVDVSPEEVESEGDED
DQQAGTYGIALYRFQALESNELDFEVGDKIRILGTLEDGWLEGRLKGKTGIFPHRFVKLC
PSNRSEETMALPQGDSFPKNSESSAGEMGDSVVEEARQDPQECEEETPDSGLPEQTSEEP
LDHVAPECVVDKISGQDEDASGSSPDVDLEGPRAEDPSTPDLSQEVNGISSLPPQVPLQP
EEEKSQHYLTAGGSRQCPDTFSKLFPLEAKTRNYSSLPPRRTYTQGWSLQKPAPHLHRAS
SLTASRVNRPGHFSHTAMASCAQKHQTSAENAASLCCAPERPKRRPGLPDKEPATEITPA
SQGDNLDLDSKLTQQLIEFEKSLSGPSTEPKKIVRRFSIMDFYSEKDIVRGSSNSLPSRN
FPERRKALRPPPPRPHTPTSTSPHLLVDQSPKPGPPLVVRPSRPAPLPPPTQQRLNTASP
KPTSCALPGWEAPEKEGSEYTEKSPAQLFPCPSVLARIQDVEHDLDMHTRAQEELNLLLE
EKQDESLRAETLETLKSYESTIQSLNLELQQLREMTLLSSQSSSLAAPSGSVSTEKPEQR
MLEKRAKVVAELLQTEKDYIRDLEMCVERVMVPLQQAQVPNIDFEGLFGNMQTVIKVSKQ
LLAALEITDAVGMSWCNCFGPGPVFLDHRDELEGTYRLYCQNHDEAISLLDIYEKDERIQ
KHLQDYLADLKGCTNYINLGSFLIKPVQRIMRYPLLLMELLNSTPESHPDKAPLTSAVLA
IKEINANINEYKRRKDLVLKYRKADEDSLMEKISKLNIHSIIKKSSRVSSHLKHLTGFAP
QLKDEAFEETEKNFRMQERLIKSFIRDLSLYLQHIRESACVKVVAAMSIWDLCMERGHHD
LEQFEKVHRYISDQLFTRFKERTERLVINPLNQLLNMFTGPYKLVQKRFDKLLDFYNCTE
RAEKLKDKKTLEDLQSARNNYEALNSQLLDELPKFQQYAQSLFTNCIHGYAEAHCDFVQK
ALEQLQPLLSLLKASDREGNLIAIFHEEHSRVLQQLQVFTFFPEALPAPRKPFERKTTDR
QSSRKALLGMPSYMLQSEELRSSLLARYPPEKLFHVQRNFNAAQDLDVSLLEGDLVGVIK
KKDPMGSQNRWLVDNGVTKGFVYSSFLKPYNPRCSHSDSSVVSHSSTESEHSGSSPSFHR
QNSSSALTFNSNSMTVSFTSGLPQKQPQDTSPLRECVPETLGVSSNTGNPETGPSPCPSD
PGFSCQRRPGNPADGTREISQPASTLRGCQRRSLHSEVLGYPVPGRSDQGSDSIKGTSRA
CQTAGDRDRGLGSSEAEGNQVYFAIYTFKARNPNELTVLANQRLRILEFKDVTGNTEWWL
AEVNGKKGYVPSNYIRKTEYT
Download sequence
Identical sequences ENSRNOP00000064242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]