SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000064253 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000064253
Domain Number 1 Region: 103-216
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-38
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 2 Region: 5-100
Classification Level Classification E-value
Superfamily C-type lectin-like 5.34e-36
Family Link domain 0.00000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000064253   Gene: ENSRNOG00000050792   Transcript: ENSRNOT00000070792
Sequence length 244
Comment pep:known chromosome:Rnor_5.0:3:42649266:42663185:1 gene:ENSRNOG00000050792 transcript:ENSRNOT00000070792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQAAGVYHREARAGRYKLTYAEAKAVCEYEGGRLATYKQLEAARKIGFHVCAAGWMAKGR
VGYPIVKPGPNCGFGKTGIIDYGIRLNRSERWDAYCYNPNAKECGGVFTDPKRIFKSPGF
PNEYDDNQVCYWHIRLKYGQRIHLSFLDFDLEHDPGCLADYVEIYDSYDDVHGFVGRYCG
DELPEDIISTGNVMTLKFLSDASVTAGGFQIKYVTVDPAPKSNQGKNTTMTGNKKFLAGR
FSHL
Download sequence
Identical sequences ENSRNOP00000064253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]