SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000064358 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000064358
Domain Number 1 Region: 73-171
Classification Level Classification E-value
Superfamily LCCL domain 3.14e-25
Family LCCL domain 0.00067
Further Details:      
 
Domain Number 2 Region: 26-69
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000144
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000064358   Gene: ENSRNOG00000000407   Transcript: ENSRNOT00000074758
Sequence length 433
Comment pep:novel chromosome:Rnor_5.0:20:35139175:35232665:1 gene:ENSRNOG00000000407 transcript:ENSRNOT00000074758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTGAGGPGVLALLFAVCAPLRLQAEELGPYCGSWAVPKELWLNSNEVTVRFQSGSHISG
RGFLLAYASSDHPDLITCLERGNHYSQEKYSKFCPAGCRDVAGDISGNTKDGYRDTSLLC
KAAIHAGIITDELGGQINLLQSKGISHYEGILANGVLSRHGSLSEKRFLFTSPGMSITTV
AIPSVIFIALLLTGTGIFAICRKKKKKGNPFVSAEAQKTGCWKQIKYPFARHQSAEFTIS
YDNEKEMTQKLDLITSDMADYQQPLMIGTGTVTRKGSTFRPMDTDTEEARVNTEASSHYD
CPHRPGRHEYALPLTHSEPEYATPIVERHLLRAHTFSTQSGYRVPGPRLTHKHSLSSGGF
PPAAGATQIESYQRPASPKPVGGGYDKPAAASSFLDSGDPASQSQMTSGGNDGYSAPRNG
LAPLNQMAVTALL
Download sequence
Identical sequences ENSRNOP00000064358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]