SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000064590 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000064590
Domain Number 1 Region: 507-697
Classification Level Classification E-value
Superfamily Sec7 domain 4.32e-66
Family Sec7 domain 0.00000475
Further Details:      
 
Domain Number 2 Region: 729-853
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000057
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000064590   Gene: ENSRNOG00000047097   Transcript: ENSRNOT00000073503
Sequence length 1099
Comment pep:known chromosome:Rnor_5.0:4:187094334:187125698:-1 gene:ENSRNOG00000047097 transcript:ENSRNOT00000073503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRKRALVEGEAPSSETGTSLDSPSAYHQGPLVPGSSLSPDHYEHTSVGAYGLYAGPGP
QQRTRRPRLQHSTSVLRKQAEEEAIKRSRSLSESYELSSDLQDKQVEMLERKYGGRLVTR
HAARTIQTAFRQYQMNKNFERLRSSMSENRMSRRIVLSNMRMQFSFEGPEKVHSSYFEGK
QVSVTNDGSQLGALVPSECGDLSDPALKSPAPSSDFADAITELEDAFSRQVKSLAESIDD
ALNCRSLHSEEVPASDTARARDTEPKPGLHGMDHRKLDEMTASYSDVTLYIDEEELSPPL
PLSQAGDRPSSTESDLRLRSGGAAQDYWALAHKEDKADTDTSCRSTPSLERPEPRLRVEH
LPLLTIEPPSDSSVELSDRSDRSSLKRQSAYERSLGGQQGSPKHGPHGGPPKGLPREEPE
LRPRPPRPLESHLAINGSANRQSKSESDYSDGDNDSINSTSNSNDTINCSSESSSRDSLR
EQTLSKQTYHKETRNSWDSPAFSNDVIRKRHYRIGLNLFNKKPEKGIQYLIERGFVPDTP
VGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSAMELDEALRKFQAHIR
VQGEAQKVERLIEAFSQRYCVCNPGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERK
MKLEDFVKNLRGVDDGEDIPRETLIGIYERIRKRELKTNEDHVSQVQKVEKLIVGKKPIG
SLHHGLGCVLSLPHRRLVCYCRLFEVPDPNKPQKLGLHQREIFLFNDLLVVTKIFQKKKN
SVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAVPGADIKVLINFNAPNPQDRKKFTDD
LRESVAEVQEMEKHRIESELEKQKGVVRPSMSQCSSLKKESGNGTLSRACLDDSYASGEG
LKRSALSSSLRDLSEAGKRGRRSSAGSLESNVEGSIISSPHMRRRATSTRECPSRPPQPV
PNSSSLLGSLFGSRRGKPPPQAHPPSAPPPAPPHAHHPGPSEGPLHGHXNKNNHPQNNQP
ALHHHHHYHPPPHLQHTHQYHHGPHSGHPPYGAHAHSHPPLPTAHPGHAGHSAHHHGQPP
APPPPTSSKAKPSGISTVV
Download sequence
Identical sequences ENSRNOP00000064590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]