SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000064682 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000064682
Domain Number 1 Region: 20-113
Classification Level Classification E-value
Superfamily Immunoglobulin 5.14e-23
Family V set domains (antibody variable domain-like) 0.0000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000064682   Gene: ENSRNOG00000046197   Transcript: ENSRNOT00000075008
Sequence length 113
Comment pep:known chromosome:Rnor_5.0:15:33503414:33503843:-1 gene:ENSRNOG00000046197 transcript:ENSRNOT00000075008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLVLLPVLGINFLLRDGQAQSVTQPDVRVTVSEEATLQLRCKYSSSVPPSLFWYVQYPQ
QGLQLLLKYYSGDPVVQGVNGFEAEFNKSDSSFHLRKASVHWSDSAVYFCALS
Download sequence
Identical sequences M0RAM4
ENSRNOP00000064682 ENSRNOP00000066576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]