SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000064712 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000064712
Domain Number 1 Region: 41-102
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000027
Family Complement control module/SCR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000064712   Gene: ENSRNOG00000045941   Transcript: ENSRNOT00000070995
Sequence length 303
Comment pep:known_by_projection chromosome:Rnor_5.0:6:112646965:112698358:1 gene:ENSRNOG00000045941 transcript:ENSRNOT00000070995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCHGRIAPKSSSEFVVTSVGHGVFLQLVILCSLLGDGLASVCPLPPEPENGGYICHPRPC
KDPLTSGSVIEYLCAEGYMLKGDYKYLTCKNGEWKPAMEVSCHLNEDKETHASLGVPALS
IVASTASSVALILLLVVLFVLLQPKLKSFHHSRREQGVSGDQVSIMVDGVQVALPSYEEA
VYGSSGHCMPPADPRVQIVLSEGSAPSGRNMPREQQLQGQAACSSAGGEDEAPGHSGLCE
AWGSQGSETVMVHQATTSSWVAGSGSSRQTHKDTADSENSDIQSLLSLTSEEYTDDIPLL
KEA
Download sequence
Identical sequences M0R5N9
ENSRNOP00000064712 XP_001053842.1.4139 XP_003750238.1.100692 XP_008763094.1.100692 XP_008763098.1.100692 XP_008774506.1.4139 XP_008774510.1.4139 XP_017449970.1.100692 XP_017449971.1.100692 XP_017449972.1.100692 XP_017458749.1.4139 XP_017458750.1.4139 XP_017458751.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]