SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000064729 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000064729
Domain Number 1 Region: 176-221
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.28e-17
Family TRASH domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000064729   Gene: ENSRNOG00000008734   Transcript: ENSRNOT00000071443
Sequence length 287
Comment pep:known_by_projection chromosome:Rnor_5.0:15:41020887:41030980:1 gene:ENSRNOG00000008734 transcript:ENSRNOT00000071443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDDDVVFIEPVQPPPSSAPLVADQRPITFTSSKNEELQGNDPKILPSSKELAPQKGSVSE
TIVIDDEEDMETNQGQEKNSSNFIERRPSETKNRTNDVDFSSSTFSRSKTKTGVGPFNPG
RMNVAGDVFQNGESAPHHNPDSWISQSASFPRNQKQQGVDSLSPVASLPKQNFQPSNQQP
TKPVKVTCANCKKPLQKGQTAYQRKGSAHLFCSTTCLSSFSHKPAPKKLCVMCKKDITTM
KGTIVAQVDSSESFQEFCSTSCLSLYEDKQSPAKGALNKSRCTICGK
Download sequence
Identical sequences ENSRNOP00000064729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]