SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000064737 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000064737
Domain Number 1 Region: 266-454
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.76e-36
Family Laminin G-like module 0.00000661
Further Details:      
 
Domain Number 2 Region: 468-668
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.28e-25
Family Laminin G-like module 0.0000649
Further Details:      
 
Domain Number 3 Region: 41-91
Classification Level Classification E-value
Superfamily GLA-domain 5.05e-20
Family GLA-domain 0.00045
Further Details:      
 
Domain Number 4 Region: 120-248
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000251
Family Growth factor receptor domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000064737
Domain Number - Region: 241-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000765
Family EGF-type module 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000064737   Gene: ENSRNOG00000048723   Transcript: ENSRNOT00000073689
Sequence length 675
Comment pep:known chromosome:Rnor_5.0:7:1199864:1279990:1 gene:ENSRNOG00000048723 transcript:ENSRNOT00000073689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLSVRFRVLLACLALVLPVSETNFLSKERASQVLVRKRRANTLLEETKKGNLERECIE
ELCNKEEAREVFENNPETDYFYPKYLGCLGAFRVGAFSAARQSANAYPDLRSCVNAIPDQ
CDPMPCNEDGYLSCKDGQGAFTCICKPGWQGDKCQFDINECKDPSNINGGCSQTCDNTPG
SYHCSCKIGFAMLTNKKDCKDVDECSLKPSVCGTAVCKNIPGDFECECPNGYRYDPSSKS
CKDVDECSENTCAQLCVNYPGGYSCYCDGKKGFKLAQDQRSCEGIPVCLSLDLDKNYELL
YLAEQFAGVVLYLKFRLPDITRFSAEFDFRTYDSEGIILYAESLDHSNWLLIALREGKIE
VQFKNEFSTQITTGGNVINNGIWNMVSVEELDDSVSIKIAKEAVMNINKLGSLFKPTDGF
LDTKIYFAGLPRKVESALIKPINPRLDGCIRGWNLMKQGALGAKEIVEGKQNKHCFLTVE
KGSYYPGSGIAQFSIDYNNVTNAEGWQINVTLNIRPSTGTGVMLALVSGDTVPFALSLVD
SGSGTSQDILVFVENSVAAHLEAITLCSEQPSQLKCNINRNGLELWTPVRKDVIYSKDLQ
RQLAILDKTMKGTVATYLGGVPDISFSATPVNAFYSGCMEVNINGVQLDLDEAISKHNDI
RAHSCPSVRKIQKNF
Download sequence
Identical sequences M0R5R0
ENSRNOP00000064737 NP_112348.2.100692 NP_112348.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]