SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000064776 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000064776
Domain Number 1 Region: 163-280
Classification Level Classification E-value
Superfamily C-type lectin-like 4.22e-38
Family Link domain 0.0028
Further Details:      
 
Domain Number 2 Region: 284-364
Classification Level Classification E-value
Superfamily C-type lectin-like 1.21e-23
Family Link domain 0.0037
Further Details:      
 
Domain Number 3 Region: 49-162
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000347
Family I set domains 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000064776   Gene: ENSRNOG00000050507   Transcript: ENSRNOT00000073102
Sequence length 400
Comment pep:known chromosome:Rnor_5.0:16:20994299:21005078:-1 gene:ENSRNOG00000050507 transcript:ENSRNOT00000073102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACAPGALGHRALWAVAWGLLLLVPVLAGAQRGRKKVVHVLEGESGSVVVQTAPGQVVSH
RGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFADVFVALGPQHRAFGPYRGRAELQ
NDGPGDASLVLRNVTLQDYGRYECEVTNELEDDAGMVKLDLEGVVFPYHPRGGRYKMTFA
EAQRACAEQDGILASAEQLHTAWRDGLDWCNAGWLRDGSVQYPVSQAREACGGSGSPGAG
GGTNGGVRNYGYRHNAEERYDAFCFTSNLPGRVFFLKPLRPVALAGAVRACAARGATVAK
VGQLFAAWKLQLLDRCTAGWLADGSARYPIVNPRTRCGGPRPGVRSLGFPDASRRLFGVY
CYRAPGAPDPAPGGWGWGWAGGGGWAGGSRDPAAWTPLRV
Download sequence
Identical sequences D3Z9H2
NYSGRC-IgSF-ENSRNOP00000027792 10116.ENSRNOP00000027792 ENSRNOP00000064776 ENSRNOP00000064949 NP_001101868.1.100692 NP_001101868.1.4139 ENSRNOP00000027792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]