SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000064819 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000064819
Domain Number 1 Region: 120-207
Classification Level Classification E-value
Superfamily Immunoglobulin 1.59e-18
Family I set domains 0.00013
Further Details:      
 
Domain Number 2 Region: 40-120
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000516
Family I set domains 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000064819   Gene: ENSRNOG00000050418   Transcript: ENSRNOT00000073643
Sequence length 267
Comment pep:known chromosome:Rnor_5.0:13:95738633:95747224:-1 gene:ENSRNOG00000050418 transcript:ENSRNOT00000073643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLETQMFQNAHSGSQWLLPPLTMLLLFAFADRQTGDLLKAVVKRDPPWIQVLKDDTVTL
TCEGTHNPGNSSTQWFHNQSSTWGQVQASYTFKATVNDSGEYRCRMAHTSLSDPIHLEVI
SDWLLLQTPQLVFEEGETITLRCHSWKNKQLTKVLLFQNGKPVRYYYQSSNFSIPKANHS
HSGNYYCKAYLGRTMHVSKPVTITVQGSATASTSSLVWFHAAFCLVMCLLFAVDTGLYFC
VRRNLQTSGEDWRKSLSVGKYKAPQDK
Download sequence
Identical sequences B0K007
ENSRNOP00000064819 NP_001129464.1.100692 NP_001129464.1.4139 XP_008767970.1.100692 XP_008767996.1.100692 XP_008767997.1.100692 XP_008767998.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]