SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000064958 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000064958
Domain Number 1 Region: 56-206
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-25
Family Phosphotyrosine-binding domain (PTB) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000064958   Gene: ENSRNOG00000048279   Transcript: ENSRNOT00000071289
Sequence length 430
Comment pep:known scaffold:Rnor_5.0:AABR06110207.1:59:1351:-1 gene:ENSRNOG00000048279 transcript:ENSRNOT00000071289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPWKKHKFELLAEAPPRQASKPKGYAVSLHYSALSSLARACPEGALSRVGSMFRSKRKK
LHITSEDPTYTVLYLGNATTIQARGDGCTDLAVGKIWSKSEAGRQGTKMKLTVSAQGIRM
VHAEERALRRPGHLYLLHRVTYCVADARLPKVFAWVYRHELKHKAVMLRCHAVLVSKPEK
AQAMALLLYQTSANALAEFKRLKRRDDARHQQQELVGAHTIPLVPLRKLLLHGPCCYKPP
VERSRSAPKLGSITEDLLGEQQEEELQEEEEEEHLEGCLEEEEEEEEEEEDRVGDGDPAE
EEAETQRALVVAMQLECEDLLDPLENGHEEALGDGGVSLGPSSGTPLPLSGCASDMKAQL
SQLISDLGDLSFGNDVSTLESDLRVTRLLSGESTGSESSIEGGGLDATSASPGNPSGPAD
STSLDEPYSS
Download sequence
Identical sequences Q4KLG0
ENSRNOP00000002355 ENSRNOP00000064958 NP_001034091.1.100692 NP_001034091.1.4139 XP_003752250.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]