SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000065005 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000065005
Domain Number 1 Region: 33-389
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.15e-52
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00029
Further Details:      
 
Domain Number 2 Region: 366-477
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.06e-31
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000065005   Gene: ENSRNOG00000027874   Transcript: ENSRNOT00000037944
Sequence length 485
Comment pep:novel chromosome:Rnor_5.0:6:147180935:147182439:1 gene:ENSRNOG00000027874 transcript:ENSRNOT00000037944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGVYCSLAKKGHFNRLPHGLKGSSVPLRTYSDQPIDADVTVIGSGPGGYVAAIEAAQLGF
KTVCIEKNETLRGTCYSRYYHLAHGKDFASRGSEIPEVRLNLEKMMEQKRSAVKALTGGA
HLFQQNKVVHVNGFGKITGKNQVIATTADSSTQVIGTKNILIATGSEVTPFLGIMIDEST
IVSFTGALSLKKVPEKLVFIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGIEISMEISK
NFQHILQNQGFKFKQYTKVTGSTKKSDGKIDVSVEAASGGKAEVIMCDVFLVCIGRWPFT
QNLGLEELGIELDPKGRIPVNTRFQTKIPNIFAIGDVVAGPTLAHEAEDEGIICVEGMAG
GVVHIDYNCVPSVIYTHPEAAWVGKSEEQLKEEGVEFKVGKFPFAANSRAKTNADTEGMV
KILGYKSTERVLGHILGPGAGEMVTEAALLEYGTSCEDIATVCHAHPTLEKQTWLHLLAN
QSTFN
Download sequence
Identical sequences ENSRNOP00000065005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]