SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000065042 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000065042
Domain Number 1 Region: 172-288
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 6.45e-16
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.015
Further Details:      
 
Domain Number 2 Region: 83-127
Classification Level Classification E-value
Superfamily TGS-like 0.000032
Family TGS domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000065042   Gene: ENSRNOG00000047563   Transcript: ENSRNOT00000074032
Sequence length 318
Comment pep:known_by_projection chromosome:Rnor_5.0:11:27815367:27830369:-1 gene:ENSRNOG00000047563 transcript:ENSRNOT00000074032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTVGRVALRRPCMGGRARWRFIATSPAAELSPAELTEMRNDLFNKEKSRQLSLTPRTE
KIEVKHVGKTDPGTVFVMNKNISTPYSCAMHLSEWYCKKSILALVDGQPWDMYKPLTKSC
EIKFLTFKDPDPREVNKVFGSSSLLICGILLDMCYCFSFSLCLTLDLRNISFFFQENLRS
FTKDAHTLIYRDLPFETLEVDAKVALEIFQHNKYKVDFIEEKASQNPERIVKLHRIGDFI
DVSEGPLIPRTSVCFQYEVSAVHNLPRSQPSLVRRFQGLSLPIHLRAQFTIWDKLLERSR
KMVTEDEITQTESTAPTQ
Download sequence
Identical sequences ENSRNOP00000065042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]