SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000065154 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000065154
Domain Number 1 Region: 38-213
Classification Level Classification E-value
Superfamily Lysozyme-like 1.69e-23
Family G-type lysozyme 0.00000864
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000065154   Gene: ENSRNOG00000050591   Transcript: ENSRNOT00000072642
Sequence length 213
Comment pep:novel chromosome:Rnor_5.0:9:44197180:44206581:-1 gene:ENSRNOG00000050591 transcript:ENSRNOT00000072642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPSVVFWGLIALIGTARGSYPGFTHSTNPHVHSRLYHGCYGDVMTMETFGAPCDINNLM
NCGIHGSEMFAEMDLKAIKPYRILIKEVGQRHCIDPALIAAIISRESHGGAVLQNGWDHK
GQRFGLMQLDKNMYHPIGSWDSKEHLLQSVGILTERIKALKRKFPTWNAAQHLKGGLTAF
KSGMETIVTPADIEGDLVDDIIARAKFYKRHGF
Download sequence
Identical sequences M0R6U6
ENSRNOP00000065154 XP_008765288.1.100692 XP_017459347.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]