SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000065176 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000065176
Domain Number 1 Region: 549-700
Classification Level Classification E-value
Superfamily PH domain-like 1.37e-38
Family Phosphotyrosine-binding domain (PTB) 0.0037
Further Details:      
 
Domain Number 2 Region: 357-377,487-545
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000024
Family SH3-domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000065176   Gene: ENSRNOG00000006938   Transcript: ENSRNOT00000074106
Sequence length 708
Comment pep:known chromosome:Rnor_5.0:3:87998492:88016197:-1 gene:ENSRNOG00000006938 transcript:ENSRNOT00000074106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERESGLSGGAASPPAASPFLGLHIASPPNFRLTHDISLEEFEDEDLSEITDECGISLQ
CKDTLSLRPPRAGLLSAGSSGSAGSRLQAEMLQMDLIDAASDTPGAEDDEEDDDELAAQR
PGVGPSKAESGQEPASRSQGQGQGPGTGSGDTYRPKRPTTLNLFPQVPRSQDTLNNNSLG
KKHSWQDRVSRSSSPLKTGEQTPPHEHICLSDELPPQGSPVPTQDRGTSTDSPCRRTAAT
QMAPPSGPPATAPGGRGHSHRDRIHYQADVRLEATEEIYLTPVQRPPDPAEPTSTFLPPT
ESRMSVSSDPDPAAYSVTAGRPHPSISEEDEGFDCLSSPEQAEPPGGGWRGSLGEPPPPP
RASLSSDTSALSYDSVKYTLVVDEHAQLELVSLRPCFGDYSDESDSATVYDNCASASSPY
ESAIGEEYEEAPQPRPPTCLSEDSTPDEPDVHFSKKFLNVFMSGRSRSSSAESFGLFSCV
INGEEHEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYY
AIEVTKEPEHMAALAKNSDWIDQFRVKFLGSVQVPYHKGNDVLCAAMQKIATTRRLTVHF
NPPSSCVLEISVRGVKIGVKADEAQEAKGNKCSHFFQLKNISFCGYHPKNNKYFGFITKH
PADHRFACHVFVSEDSTKALAESVGRAFQQFYKQFVEYTCPTEDIYLE
Download sequence
Identical sequences Q9R237
ENSRNOP00000065176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]