SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000065222 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000065222
Domain Number 1 Region: 218-286
Classification Level Classification E-value
Superfamily Leucine zipper domain 5.56e-22
Family Leucine zipper domain 0.0000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000065222   Gene: ENSRNOG00000049393   Transcript: ENSRNOT00000072673
Sequence length 296
Comment pep:known chromosome:Rnor_5.0:3:170577777:170578880:1 gene:ENSRNOG00000049393 transcript:ENSRNOT00000072673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRLLAWDAACLPPPPAAFRPMEVANFYYEPDCLAYGAKAARAAPRAPAAEPAIGEHERA
IFSPYLEPLAPAAADFAAPAPAHHDFLSDLFADDYGAKPSKKPSDYGYVSLGRAGAKAAP
PACFPPPPPAALKAEPGFEPADCKRADDAPAMAAGFPFALRAYLGYQATPSGSSGSLSTS
SSSSPPGTPSPADAKAAPAACFAGPPAAPAKAKAKKAVDKLSDEYKMRRERNNIAVRKSR
DKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASAGHC
Download sequence
Identical sequences ENSRNOP00000065222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]