SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000065991 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000065991
Domain Number 1 Region: 12-205
Classification Level Classification E-value
Superfamily t-snare proteins 1.65e-43
Family t-snare proteins 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000065991   Gene: ENSRNOG00000048248   Transcript: ENSRNOT00000072943
Sequence length 245
Comment pep:novel chromosome:Rnor_5.0:1:25013209:25025643:-1 gene:ENSRNOG00000048248 transcript:ENSRNOT00000072943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CNHSLISITIAAEIQRTLNQLGTPQDTPELRQQLQQEQQYTNQLAKETDKYIKEFGFLPT
TPSEQRQRKIQKDRLVAEFTTALTNFQKVQRQAAEREKEFVARVRASSRVSVGTGGFPED
SSKEKNFVSWESQTQPQVQVQDEEITEDDLRLIHERESSIRQLEADIMDINEIFKDLGMM
IHEQGDVIDSIEANVESAEVHVQQANQQLSRAANYQRKSRKTLCIIILILVVGIVIIFFI
VWGLK
Download sequence
Identical sequences ENSRNOP00000065991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]