SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000066102 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000066102
Domain Number 1 Region: 81-162
Classification Level Classification E-value
Superfamily HMG-box 3.14e-32
Family HMG-box 0.0000221
Further Details:      
 
Domain Number 2 Region: 3-79
Classification Level Classification E-value
Superfamily HMG-box 4.32e-26
Family HMG-box 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000066102   Gene: ENSRNOG00000050910   Transcript: ENSRNOT00000074314
Sequence length 200
Comment pep:known chromosome:Rnor_5.0:17:37996456:37998057:1 gene:ENSRNOG00000050910 transcript:ENSRNOT00000074314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSSKEKSKF
DEMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSANPGISI
GDVAKKLGEMWNNLSDSEKQPYMTKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVARKKV
EEEEEEEEEEEEEEEEEEDE
Download sequence
Identical sequences B0BN99
ENSRNOP00000015044 ENSRNOP00000066102 ENSRNOP00000015044 10116.ENSRNOP00000015044 NP_001166812.1.100692 XP_017443900.1.4139 XP_017454960.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]